newgamess2015-12-17 17:56:34
Select one of the game modes before you start playing the game, is it going to be the jigsaw mode or the sliding mode? As you probably know, the goal inside these games is to put the pieces from the puzzle in their right positions to complete th..
puzzlejigsawsliding
newgamess2015-12-17 17:00:50
adina2015-12-17 13:57:49
Elsa is quite naughty for the holidays. She drew some Santa Claus pictures on Jack s notebook. She thinks this is a nice surprise for Jack but he may not appreciate Elsa s work. Help Elsa finish the drawing on Jack s notebook without being caught. Le..
elsafrozennaughtychristmasslacking
hiddenogames2015-12-17 10:58:54
E333E Christmas House escape is a another point and click escape game from E333E.com. In this game you are trapped inside in an elf’s house. The door of the house is locked. You want escape from there by finding useful hints and objects. Find t..
e333e christmas house escapeescape gameschristmas gamesnew escape gamese333egames
Anakids2015-12-17 09:55:41
Tinker Bell down with fever for the past three days. Tomorrow is the birthday of the girl. She will be very happy if you decorate the room of the girl. Now she is not at home. She has gone for shopping. While she comes back, let her be take..
decorkidsgirlstinkerbell
hiddenogames2015-12-17 06:29:05
The Revenant-Hidden Numbers is another type of number based new hidden number game developed by hiddnogames.com. Check your number finding skill. In this game you have to find all those hidden numbers which are hidden in this The Revenant movie pictures before times&nbs..
the revenant-hidden numbershidden numbershidden gamesmovie gameshidden objects games
Enagames12015-12-17 06:14:03
Residence escape is an interesting point and click type new room escape game developed by ENA games for free. Dramatise a situation that you are trapped inside a house. You need to escape from the house by finding the objects for figuring out the puzzles. ..
ena escape games escape games point and click games
Enagames12015-12-17 06:06:28
Tremendous escape 4 is an enchanting point and click type new room escape game developed by ENA games for free. Assume a situation that somebody locked you inside the house without your knowledge. Meanwhile you are in a hurry to catch the flight to attend ..
hiddenogames2015-12-17 05:03:55
Get Christmas Gift is another new point and click room escape game from wowescape.com. In this game someone trapped Santa and locked him with his gifts inside a snow forest. No one is there to help Santa. You have to help Santa to escape from th..
get christmas giftwowescape gamesnew escape gameslive escape gameschristmas games
newgamess2015-12-16 21:00:41
manchebt2015-12-16 15:57:19
Chevrolet Hidden Tires is a free online car and hidden object game. That is 15 car tires on 5 levels. Use mouse and click on the tire when you see one. The time is limited so be fast and find all hidden tires before time runs out. You have&..
carpuzzlefunkidshidden
newgamess2015-12-16 13:17:31
newgamess2015-12-16 11:26:12
hiddenogames2015-12-16 10:48:44
Christmas Chimney Escape is another new point and click room escape game from games2rule.com. In this game, While getting ready Santa came to know that he was locked inside his house. Its already late he need to distubute gifts. He dont know how to escape ..
christmas chimney escapeescape gameslive escapechristmas escape gamesgames2rule games
FlashGameHQ2015-12-16 08:50:47
Challenge your skills and join this Cube-Crush HD tournament! Combining the excitement of a 3 and 4 color mode into a challenge for everyone. The goal is simple: Crush as many cubes as possible. The more cubes you can crush with one click, the higher your&nb..
cubecolormatchcollapseflashgamehq
FlashGameHQ2015-12-16 08:50:01
Challenge your card skills and join this Solitaire tournament! Solitaire TriPeaks Tournament is a exciting version of a classic solitaire game. Your goal is to clear the game board by combining the cards into a sequence and moving them from the tableau to ..
solitairetripeakscardpyramidflashgamehq
Enagames12015-12-16 07:15:26
Rescue dog from house is an intriguing point and click type new room escape game developed by ENA games for free. Dream up a situation that you are a pet lover and you have a dog which was mischievous. It always creates problems with your neighbours. ..
Enagames12015-12-16 07:06:20
List the curse of princess is an enchanting point and click type new escape game developed by ENA games for free. Dream up a situation there lived a beautiful princess in a province. She was praised by everyone in their kingdom for her kindness and helpin..
hiddenogames2015-12-16 06:14:24
Christmas Fantasy Stars is another type of point and click new hidden star game developed by hiddnogames.com. Find all the hidden stars within the time duration which are hidden on this Christmas Fantasy pictures. Be careful because some object can make you co..
christmas fantasy starshidden starshidden gameshiddenogameshidden fantasy games
hiddenogames2015-12-16 05:53:46
Shortage of gifts! Makes Santa to run a restaurant. Prepare and serve different kind of hot cookies to the customers. Make money by serving the cookies before customer waiting time exceeds. As the kids are eagerly waiting for Santa’s Gift, convert&nbs..
santa pancake cookingchristmas gamesgames2dress gamesnew games2dress gamescooking games
