FlashGameHQ2015-12-16 08:50:01
Challenge your card skills and join this Solitaire tournament! Solitaire TriPeaks Tournament is a exciting version of a classic solitaire game. Your goal is to clear the game board by combining the cards into a sequence and moving them from the tableau to ..
solitairetripeakscardpyramidflashgamehq
FlashGameHQ2015-07-26 13:44:17
Solitaire Tripeaks is a classic card game with 3 difficulty levels. Update 4.0 Gamersafe Leaderboard Less ads